Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PDLIM3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | PDLIM3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP155197
|
Novus Biologicals
NBP155197 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
PDLIM3 Polyclonal specifically detects PDLIM3 in Human samples. It is validated for Western Blot.Specifications
| PDLIM3 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| Actinin-associated LIM protein, ALPFLJ26096, Alpha-actinin-2-associated LIM protein, DKFZp686L0362, enigma homolog, PDZ and LIM domain 3, PDZ and LIM domain protein 3 | |
| PDLIM3 | |
| IgG | |
| Affinity Purified | |
| 39 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q53GG5 | |
| 27295 | |
| Synthetic peptides corresponding to PDLIM3(PDZ and LIM domain 3) The peptide sequence was selected from the N terminal of PDLIM3. Peptide sequence PQTVILPGPAPWGFRLSGGIDFNQPLVITRITPGSKAAAANLCPGDVILA. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title