Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PDZRN4 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen PDZRN4
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15492520
View Documents
Novus Biologicals
NBP15492520UL
20 μL
Each for $152.22
Add to cart
 
NBP154925
View Documents
Novus Biologicals
NBP154925
100 μL
Each for $436.00
Add to cart
 
Description

Description

PDZRN4 Polyclonal specifically detects PDZRN4 in Human samples. It is validated for Western Blot.
Specifications

Specifications

PDZRN4
Polyclonal
Rabbit
Zinc Finger
DKFZp434B0417, IMAGE5767589, Ligand of Numb protein X 4, LNX4FLJ33777, PDZ domain containing ring finger 4, PDZ domain-containing RING finger protein 4, SAMCAP3L, SEMACAP3-like protein, SEMCAP3L
PDZRN4
IgG
Affinity Purified
89 kDa
Western Blot
Unconjugated
RUO
B4DG65
29951
Synthetic peptides corresponding to PDZRN4(PDZ domain containing ring finger 4) The peptide sequence was selected from the N terminal of PDZRN4. Peptide sequence SDSCHSLHPMEHEFYEDNEYISSLPADADRTEDFEYEEVELCRVSSQEKL.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit