Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PDZRN4 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | PDZRN4 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15492520
|
Novus Biologicals
NBP15492520UL |
20 μL |
Each for $152.22
|
|
NBP154925
|
Novus Biologicals
NBP154925 |
100 μL |
Each for $436.00
|
|
Description
PDZRN4 Polyclonal specifically detects PDZRN4 in Human samples. It is validated for Western Blot.Specifications
| PDZRN4 | |
| Polyclonal | |
| Rabbit | |
| Zinc Finger | |
| DKFZp434B0417, IMAGE5767589, Ligand of Numb protein X 4, LNX4FLJ33777, PDZ domain containing ring finger 4, PDZ domain-containing RING finger protein 4, SAMCAP3L, SEMACAP3-like protein, SEMCAP3L | |
| PDZRN4 | |
| IgG | |
| Affinity Purified | |
| 89 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| B4DG65 | |
| 29951 | |
| Synthetic peptides corresponding to PDZRN4(PDZ domain containing ring finger 4) The peptide sequence was selected from the N terminal of PDZRN4. Peptide sequence SDSCHSLHPMEHEFYEDNEYISSLPADADRTEDFEYEEVELCRVSSQEKL. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title