Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PEDFR/PNPLA2/ATGL Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP258046

Catalog No. NBP258046


Add to cart

Description

Description

PEDFR/PNPLA2/ATGL Polyclonal antibody specifically detects PEDFR/PNPLA2/ATGL in Human samples. It is validated for Immunocytochemistry, Immunofluorescence.
Specifications

Specifications

PEDFR/PNPLA2/ATGL
Unconjugated
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Adipose triglyceride lipase, ATGL1110001C14Rik, Calcium-independent phospholipase A2, Desnutrin, EC 3.1.1.3, FP17548, IPLA2-zeta, patatin-like phospholipase domain containing 2, patatin-like phospholipase domain-containing protein 2, patatin-like phospholipase domain-containing protein 2-like, PEDF-R, Pigment epithelium-derived factor, Transport-secretion protein 2, transport-secretion protein 2.2, triglyceride hydrolase, TTS2.2, TTS-2.2, TTS2DKFZp667M109
Rabbit
IgG
100 ul
Autophagy, Cancer, Diabetes Research, Lipid and Metabolism, Lipid Droplets, Signal Transduction
Primary
57104
Human
Immunocytochemistry, Immunofluorescence
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Affinity Purified
PNPLA2
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SICQYLVMRAKRKLGRHLPSRLPEQVELRRVQSLPSVPLSCAAYREALPGWMRNNLSLGDALAKWEECQRQLLLGLFCTNVAFPPEALRMRA
Affinity purified
RUO
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Polyclonal
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only