Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PEG10 Rabbit anti-Human, Polyclonal , Abnova™

Rabbit polyclonal antibody raised against recombinant human PEG10.

Manufacturer:  Abnova Corporation PAB29434

Catalog No. 89-934-759


Add to cart

Description

Description

This gene includes two overlapping reading frames of the same transcript encoding distinct isoforms. The shorter isoform has a CCHC-type zinc finger motif containing a sequence characteristic of gag proteins of most retroviruses and some retrotransposons, and it functions in part by interacting with members of the TGF-beta receptor family. The longer isoform has the active-site DSG consensus sequence of the protease domain of pol proteins. The longer isoform is the result of -1 translational frameshifting that is also seen in some retroviruses. Expression of these two isoforms only comes from the paternal allele due to imprinting. Increased gene expression (as observed by an increase in mRNA levels) is associated with hepatocellular carcinomas. [provided by RefSeq]

Sequence: QCIHIERRLARAAAARKPRSPPRALVLPHIASHHQVDPTEPVGGARMRLTQEEKERRRKLNLCLYCGTGGHYADNCPAKASKSS
Specifications

Specifications

PEG10
Unconjugated
Immunohistochemistry (1:500-1:1000) Immunofluorescence (1-4 ug/mL) The optimal working dilution should be determined by the end user.
Liquid
PEG10
Recombinant protein corresponding to human PEG10.
Antigen affinity purification
RUO
Primary
23089
Immunofluorescence, Immunohistochemistry (PFA fixed)
Rabbit polyclonal antibody raised against recombinant human PEG10.
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Edr/HB-1/KIAA1051/MEF3L/Mar2/Mart2/RGAG3
Rabbit
IgG
100 uL
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Polyclonal
Human
SDS
Documents
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit