PELI3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156410

Catalog No. NBP156410

Description

PELI3 Polyclonal specifically detects PELI3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: PELI3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: MGC35521, pellino 3, pellino homolog 3 (Drosophila), Pellino-3, protein pellino homolog 3
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 246330
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8N2H9-2
• Gene Symbols: PELI3
• Immunogen: Synthetic peptides corresponding to PELI3(pellino homolog 3 (Drosophila)) The peptide sequence was selected from the N terminal of PELI3. Peptide sequence VLEGNPEVGSPRTSDLQHRGNKGSCVLSSPGEDAQPGEEPIKYGELIVLG.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Pig: 100%; Bovine: 92%; Rabbit: 92%; Mouse: 91%; Rat: 85%; Equine: 84%.
• Target Species: Human, Mouse, Rat, Porcine, Bovine, Equine, Guinea Pig, Rabbit
• Isotype: IgG