Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PELI3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | PELI3 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP156410
|
Novus Biologicals
NBP156410 |
100 μL |
Each of 1 for $436.00
|
|
Description
PELI3 Polyclonal specifically detects PELI3 in Human samples. It is validated for Western Blot.Specifications
PELI3 | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
MGC35521, pellino 3, pellino homolog 3 (Drosophila), Pellino-3, protein pellino homolog 3 | |
PELI3 | |
IgG | |
Affinity Purified |
Western Blot | |
Unconjugated | |
RUO | |
Q8N2H9-2 | |
246330 | |
Synthetic peptides corresponding to PELI3(pellino homolog 3 (Drosophila)) The peptide sequence was selected from the N terminal of PELI3. Peptide sequence VLEGNPEVGSPRTSDLQHRGNKGSCVLSSPGEDAQPGEEPIKYGELIVLG. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title