Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PEX10 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$149.00 - $329.00

Specifications

Antigen PEX10
Immunogen Synthetic peptides corresponding to PEX10(peroxisome biogenesis factor 10) The peptide sequence was selected from the C terminal of PEX10. Peptide sequence ERRHPTATPCGHLFCWECITAWCSSKAECPLCREKFPPQKLIYLRHYR.
Host Species Rabbit
Primary or Secondary Primary
Monoclonal or Polyclonal Polyclonal
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP16005020 View Documents Novus BiologicalsSupplier Diversity Partner
NBP16005020UL
20ul Each for $149.00
Add to cart
 
NBP160050 View Documents Novus BiologicalsSupplier Diversity Partner
NBP160050
100 ul Each for $329.00
Add to cart
 
Description

Description

PEX10 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

PEX10
Rabbit
Polyclonal
Unconjugated
5192
Affinity Purified
Western Blot
RUO
Synthetic peptides corresponding to PEX10(peroxisome biogenesis factor 10) The peptide sequence was selected from the C terminal of PEX10. Peptide sequence ERRHPTATPCGHLFCWECITAWCSSKAECPLCREKFPPQKLIYLRHYR.
Primary
IgG
NALD, peroxin 10, Peroxin-10, peroxisomal biogenesis factor 10MGC1998, Peroxisome assembly protein 10, RING finger protein 69, RNF69peroxisome biogenesis factor 10
PBS & 2% Sucrose. with No Preservative
Immunogen affinity purified
Store at -20C. Avoid freeze-thaw cycles.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit