Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PEX11A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15970520UL
Description
PEX11A Polyclonal specifically detects PEX11A in Human samples. It is validated for Western Blot.Specifications
PEX11A | |
Polyclonal | |
Western Blot 0.2-1 ug/ml | |
O75192 | |
PEX11A | |
Synthetic peptides corresponding to PEX11A(peroxisomal biogenesis factor 11A) The peptide sequence was selected from the middle region of PEX11A (NP_003838). Peptide sequence MKRVTCDRAKKEKSASQDPLWFSVAEEETEWLQSFLLLLFRSLKQHPPLL. | |
Affinity Purified | |
RUO | |
8800 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
28 kDa peroxisomal integral membrane protein, hsPEX11p, MGC119947, MGC138534, Peroxin-11A, peroxisomal biogenesis factor 11 alpha, Peroxisomal biogenesis factor 11Aperoxin-11A, peroxisomal membrane protein 11A, PEX11, PEX11-alpha, PMP28, Protein PEX11 homolog alpha | |
Rabbit | |
28 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction