PEX26 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP155115

Catalog No. NBP155115

Description

PEX26 Polyclonal specifically detects PEX26 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: PEX26
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q7Z412
• Gene Symbols: PEX26
• Immunogen: Synthetic peptides corresponding to PEX26(peroxisomal biogenesis factor 26) The peptide sequence was selected from the middle region of PEX26. Peptide sequence ELVVGSAAFGEERRLDVLQAIHTARQQQKQEHSGSEEAQKPNLEGSVSHK.
• Quantity: 100 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 55670
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: FLJ20695, peroxin-26, peroxisomal biogenesis factor 26, peroxisome assembly protein 26, peroxisome biogenesis disorder, complementation group 8, peroxisome biogenesis disorder, complementation group A, peroxisome biogenesis factor 26, PEX26M1T, Pex26pM1T
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Equine: 85%; Bovine: 78%.
• Target Species: Human, Porcine, Bovine, Equine
• Isotype: IgG