Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PEX26 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP15511520UL

 View more versions of this product

Catalog No. NBP1551520


Add to cart

Description

Description

PEX26 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

PEX26
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
PEX26
Synthetic peptides corresponding to PEX26(peroxisomal biogenesis factor 26) The peptide sequence was selected from the middle region of PEX26. Peptide sequence ELVVGSAAFGEERRLDVLQAIHTARQQQKQEHSGSEEAQKPNLEGSVSHK.
Immunogen affinity purified
RUO
Primary
55670
Western Blot
Western Blot 1:100-1:2000
Q7Z412
FLJ20695, peroxin-26, peroxisomal biogenesis factor 26, peroxisome assembly protein 26, peroxisome biogenesis disorder, complementation group 8, peroxisome biogenesis disorder, complementation group A, peroxisome biogenesis factor 26, PEX26M1T, Pex26pM1T
Rabbit
IgG
20ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit