Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PEX26 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | PEX26 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP155115
|
Novus Biologicals
NBP155115 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
PEX26 Polyclonal specifically detects PEX26 in Human samples. It is validated for Western Blot.Specifications
| PEX26 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| FLJ20695, peroxin-26, peroxisomal biogenesis factor 26, peroxisome assembly protein 26, peroxisome biogenesis disorder, complementation group 8, peroxisome biogenesis disorder, complementation group A, peroxisome biogenesis factor 26, PEX26M1T, Pex26pM1T | |
| PEX26 | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q7Z412 | |
| 55670 | |
| Synthetic peptides corresponding to PEX26(peroxisomal biogenesis factor 26) The peptide sequence was selected from the middle region of PEX26. Peptide sequence ELVVGSAAFGEERRLDVLQAIHTARQQQKQEHSGSEEAQKPNLEGSVSHK. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title