Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PEX5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15458520UL
Description
PEX5 Polyclonal specifically detects PEX5 in Human samples. It is validated for Western Blot.Specifications
PEX5 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
P50542-3 | |
PEX5 | |
Synthetic peptides corresponding to PEX5(peroxisomal biogenesis factor 5) The peptide sequence was selected from the N terminal of PEX5. Peptide sequence TATDRWYDEYHPEEDLQHTASDFVAKVDDPKLANSEFLKFVRQIGEGQVS. | |
Affinity Purified | |
RUO | |
5830 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
FLJ50634, FLJ50721, Peroxin-5, peroxisomal biogenesis factor 5, Peroxisomal C-terminal targeting signal import receptor, peroxisomal targeting signal 1 receptor, peroxisomal targeting signal import receptor, peroxisomal targeting signal receptor 1, Peroxisome receptor 1peroxin-5, PTS1 receptor, PTS1-BP, PTS1RFLJ51948, PXR1peroxisomal targeting signal 1 (SKL type) receptor | |
Rabbit | |
70 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction