Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PEX5L Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
Antigen | PEX5L |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP191484
|
Novus Biologicals
NBP191484 |
100 μL |
Each of 1 for $482.50
|
|
|||||
Description
PEX5L Polyclonal specifically detects PEX5L in Mouse samples. It is validated for Western Blot.Specifications
PEX5L | |
Polyclonal | |
Rabbit | |
NP_067458 | |
51555 | |
Synthetic peptide directed towards the C terminal of human Pex2. Peptide sequence QRKSRNQQQVPHPAISGNIWAALRIALSLMDQPELFQAANLGDLDVLLRA. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
PEX5-related protein, peroxisomal biogenesis factor 5-like, PEX5R, PEX5RP, PXR2, PXR2B | |
PEX5L | |
IgG | |
68 kDa |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title