Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PGCP Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | PGCP |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP158037
|
Novus Biologicals
NBP158037 |
100 μL |
Each of 1 for $436.00
|
|
Description
PGCP Polyclonal specifically detects PGCP in Human samples. It is validated for Western Blot.Specifications
PGCP | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
aminopeptidase, EC 3.4.17, EC 3.4.17.-, plasma glutamate carboxypeptidase | |
CPQ | |
IgG | |
Affinity Purified |
Western Blot | |
Unconjugated | |
RUO | |
Q9Y646 | |
10404 | |
Synthetic peptides corresponding to PGCP(plasma glutamate carboxypeptidase) The peptide sequence was selected from the N terminal of PGCP. Peptide sequence VDTVGPRLSGSKNLEKAIQIMYQNLQQDGLEKVHLEPVRIPHWERGEESA. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title