Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PGL2 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310124100UL
Description
PGL2 Polyclonal specifically detects PGL2 in Mouse samples. It is validated for Western Blot.Specifications
PGL2 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
C11orf79, FLJ20487, hSDH5, paraganglioma or familial glomus tumors 2, PGL2chromosome 11 open reading frame 79, SDH5SDH assembly factor 2, succinate dehydrogenase assembly factor 2, mitochondrial, succinate dehydrogenase complex assembly factor 2, Succinate dehydrogenase subunit 5, mitochondrial | |
The immunogen is a synthetic peptide directed towards the middle terminal region of Mouse PGL2 (NP_079609.2). Peptide sequence PSVTSFRRFYRGDSPTDSQKDMIEIPLPPWQERTDESIETKRARLLYESR | |
100 μg | |
Primary | |
Mouse | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
54949 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction