Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PGM1 Antibody (CL3299), Novus Biologicals™
Mouse Monoclonal Antibody
Supplier: Novus Biologicals NBP261618
Description
PGM1 Monoclonal specifically detects PGM1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
PGM1 | |
Monoclonal | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
PGM1 | |
This antibody was developed against a recombinant protein corresponding to amino acids: SILATRKQSVEDILKDHWQKHGRNFFTRYDYEEVEAEGANKMMKDLEALMFDRSFVGKQFSANDKVYTVEKADNFEYSD | |
100 μL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
IgG1 |
Western Blot, Immunohistochemistry | |
CL3299 | |
Western Blot 1 ug/ml, Immunohistochemistry 1:2500 - 1:5000 | |
EC 5.4.2, EC 5.4.2.2, Glucose phosphomutase 1, GSD14, PGM 1, phosphoglucomutase 1, phosphoglucomutase-1 | |
Mouse | |
Protein A purified | |
Lipid and Metabolism | |
5236 | |
Human | |
Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction