Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PHF11 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP180054

 View more versions of this product

Catalog No. NBP180054

Add to cart



PHF11 Polyclonal antibody specifically detects PHF11 in Human, Canine samples. It is validated for Western Blot, Immunohistochemistry.


PBS & 2% Sucrose. with 0.09% Sodium Azide
Affinity Purified
Synthetic peptide directed towards the middle region of human PHF11. Peptide sequence FSGVKRKRGRKKPLSGNHVQPPETMKCNTFIRQVKEEHGRHTDATVKVPF.
37 kDa
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Immunohistochemistry, Western Blot
Western Blot 1:1000, Immunohistochemistry
APY, BCAPIGHER, BRCA1 C-terminus-associated protein, IgE responsiveness (atopic), IGEL, IGER, NYREN34, NY-REN-34, NY-REN-34 antigen, PHD finger protein 11, Renal carcinoma antigen NY-REN-34
Immunogen affinity purified
Canine, Human
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit