Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PHF19 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen PHF19
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP1793520
View Documents
Novus Biologicals
NBP17935120UL
20 μL
Each for $152.22
Add to cart
 
NBP179351
View Documents
Novus Biologicals
NBP179351
100 μL
Each for $436.00
Add to cart
 
Description

Description

PHF19 Polyclonal specifically detects PHF19 in Human samples. It is validated for Western Blot.
Specifications

Specifications

PHF19
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
DKFZP727G051, hPCL3, MGC131698, MGC149712, MGC23929, MTF2L1, PCL3MGC149713, PHD finger protein 19, polycomb like 3, polycomb-like 3, Polycomb-like protein 3
PHF19
IgG
Affinity Purified
Western Blot
Unconjugated
RUO
NP_001009936
26147
Synthetic peptide directed towards the C terminal of human PHF19The immunogen for this antibody is PHF19. Peptide Sequence: RRCIFALAVRVSLPSSPVPASPASSSGADQRLPSQSLSSKQKGHTWALET
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit