Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PHF19 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | PHF19 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP1793520
|
Novus Biologicals
NBP17935120UL |
20 μL |
Each for $152.22
|
|
NBP179351
|
Novus Biologicals
NBP179351 |
100 μL |
Each for $436.00
|
|
Description
PHF19 Polyclonal specifically detects PHF19 in Human samples. It is validated for Western Blot.Specifications
| PHF19 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| DKFZP727G051, hPCL3, MGC131698, MGC149712, MGC23929, MTF2L1, PCL3MGC149713, PHD finger protein 19, polycomb like 3, polycomb-like 3, Polycomb-like protein 3 | |
| PHF19 | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_001009936 | |
| 26147 | |
| Synthetic peptide directed towards the C terminal of human PHF19The immunogen for this antibody is PHF19. Peptide Sequence: RRCIFALAVRVSLPSSPVPASPASSSGADQRLPSQSLSSKQKGHTWALET | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title