Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PHLDA1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP153065

 View more versions of this product

Catalog No. NBP153065

Add to cart



PHLDA1 Polyclonal antibody specifically detects PHLDA1 in Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit samples. It is validated for Western Blot.


PBS and 2% Sucrose with 0.09% Sodium Azide
Apoptosis-associated nuclear protein, DT1P1B11, MGC131738, PHRIPT-cell death-associated gene 51 protein, pleckstrin homology-like domain family A member 1, pleckstrin homology-like domain, family A, member 1, PQ-rich protein, Proline- and glutamine-rich protein, Proline- and histidine-rich protein, proline-histidine rich protein, TDAG51PQR protein
Immunogen affinity purified
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat
Western Blot
Western Blot 1:100-1:2000
Affinity Purified
Synthetic peptides corresponding to PHLDA1(pleckstrin homology-like domain, family A, member 1) The peptide sequence was selected from the middle region of PHLDA1. Peptide sequence PAVASLEPPVKLKELHFSNMKTVDCVERKGKYMYFTVVMAEGKEIDFRCP.
45 kDa
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit