Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Phosphoglucomutase 5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
Antigen | Phosphoglucomutase 5 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP174091
|
Novus Biologicals
NBP174091 |
100 μL |
Each of 1 for $482.50
|
|
|||||
Description
Phosphoglucomutase 5 Polyclonal specifically detects Phosphoglucomutase 5 in Human samples. It is validated for Western Blot.Specifications
Phosphoglucomutase 5 | |
Polyclonal | |
Rabbit | |
aciculin, EC 5.4.2.2, PGM-RP, PGMRPphosphoglucomutase-like protein 5, phosphoglucomutase 5, Phosphoglucomutase-related protein | |
PGM5 | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
5239 | |
Synthetic peptides corresponding to the N terminal of PGM5. Immunizing peptide sequence IPVLTVPTAPYEDQRPAGGGGLRRPTGLFEGQRNYLPNFIQSVLSSIDLR. | |
Primary |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title