Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Phospholipase C delta 1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | Phospholipase C delta 1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP158918
|
Novus Biologicals
NBP158918 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
Phospholipase C delta 1 Polyclonal specifically detects Phospholipase C delta 1 in Human samples. It is validated for Western Blot.Specifications
| Phospholipase C delta 1 | |
| Polyclonal | |
| Rabbit | |
| Lipid and Metabolism | |
| P51178 | |
| 5333 | |
| Synthetic peptides corresponding to PLCD1(phospholipase C, delta 1) The peptide sequence was selected from the N terminal of PLCD1. Peptide sequence DIQEVRMGHRTEGLEKFARDVPEDRCFSIVFKDQRNTLDLIAPSPADAQH. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase delta-1, EC 3.1.4.11, Phosphoinositide phospholipase C-delta-1, phospholipase C, delta 1, Phospholipase C-delta-1, Phospholipase C-III, PLC-delta-1, PLC-III | |
| PLCD1 | |
| IgG | |
| Affinity Purified | |
| 86 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title