Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Phosphoserine phosphatase Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
$436.00
Specifications
| Antigen | Phosphoserine phosphatase |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP156848
|
Novus Biologicals
NBP156848 |
100 μL |
Each for $436.00
|
|
NBP15684820
|
Novus Biologicals
NBP15684820UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
Phosphoserine phosphatase Polyclonal specifically detects Phosphoserine phosphatase in Human samples. It is validated for Western Blot.Specifications
| Phosphoserine phosphatase | |
| Polyclonal | |
| Rabbit | |
| Lipid and Metabolism | |
| P78330 | |
| 5723 | |
| Synthetic peptides corresponding to PSPH(phosphoserine phosphatase) The peptide sequence was selected from the middle region of PSPH. Peptide sequence IMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELE. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| L-3-phosphoserine phosphatase, O-phosphoserine phosphohydrolase, phosphoserine phosphatase, PSPase, PSPEC 3.1.3.3 | |
| PSPH | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title