Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Phosphoserine phosphatase Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

$436.00

Specifications

Antigen Phosphoserine phosphatase
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP156848
View Documents
Novus Biologicals
NBP156848
100 μL
Each for $436.00
Add to cart
 
NBP15684820
View Documents
Novus Biologicals
NBP15684820UL
20 μL This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. N/A
Description

Description

Phosphoserine phosphatase Polyclonal specifically detects Phosphoserine phosphatase in Human samples. It is validated for Western Blot.
Specifications

Specifications

Phosphoserine phosphatase
Polyclonal
Rabbit
Lipid and Metabolism
P78330
5723
Synthetic peptides corresponding to PSPH(phosphoserine phosphatase) The peptide sequence was selected from the middle region of PSPH. Peptide sequence IMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELE.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
PBS and 2% Sucrose with 0.09% Sodium Azide
L-3-phosphoserine phosphatase, O-phosphoserine phosphohydrolase, phosphoserine phosphatase, PSPase, PSPEC 3.1.3.3
PSPH
IgG
Affinity Purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit