Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PHYHIP Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | PHYHIP |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP156336
|
Novus Biologicals
NBP156336 |
100 μL |
Each for $436.00
|
|
NBP15633620
|
Novus Biologicals
NBP15633620UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
PHYHIP Polyclonal specifically detects PHYHIP in Human samples. It is validated for Western Blot.Specifications
| PHYHIP | |
| Polyclonal | |
| Rabbit | |
| Q92561 | |
| 9796 | |
| Synthetic peptides corresponding to PHYHIP(phytanoyl-CoA 2-hydroxylase interacting protein) The peptide sequence was selected from the N terminal of PHYHIP. Peptide sequence KFKHRDVPTKLVAKAVPLPMTVRGHWFLSPRTEYSVAVQTAVKQSDGEYL. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| DYRK1A interacting protein 3, DYRK1AP3, KIAA0273PAHX-AP1, PAHX-AP, PAHXAP1, phytanoyl-CoA 2-hydroxylase interacting protein, phytanoyl-CoA alpha-hydroxylase associated protein, phytanoyl-CoA hydroxylase interacting protein, Phytanoyl-CoA hydroxylase-associated protein 1, phytanoyl-CoA hydroxylase-interacting protein | |
| PHYHIP | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title