Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PI4KB/PI4KIII beta Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP30934625UL

 View more versions of this product

Catalog No. NB123594

Add to cart



PI4KB/PI4KIII beta Polyclonal antibody specifically detects PI4KB/PI4KIII beta in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)


PBS buffer, 2% sucrose
DKFZp686O1820, EC 2.7.1, EC, FLJ30129, phosphatidylinositol 4-kinase, catalytic, beta, pi4K92, PI4Kbeta, PI4K-beta, PI4KIIIBETA, type III phosphatidylinositol 4-kinase beta, wortmannin-sensitive
The immunogen is a synthetic peptide directed towards the middle region of human PI4KB/PI4KIII beta (NP_002642). Peptide sequence HMDKVVQIVEIMQQGSQLPCFHGSSTIRNLKERFHMSMTEEQLQLLVEQM
25 μg
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
Affinity purified
Product Certifications


Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit