Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PI4KB/PI4KIII beta Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
Antigen | PI4KB/PI4KIII beta |
---|---|
Dilution | Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin |
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NB123593
|
Novus Biologicals
NBP309346100UL |
100 μg |
Each of 1 for $482.50
|
|
|||||
Description
PI4KB/PI4KIII beta Polyclonal specifically detects PI4KB/PI4KIII beta in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
PI4KB/PI4KIII beta | |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
Rabbit | |
Human | |
DKFZp686O1820, EC 2.7.1, EC 2.7.1.67, FLJ30129, phosphatidylinositol 4-kinase, catalytic, beta, pi4K92, PI4Kbeta, PI4K-beta, PI4KIIIBETA, type III phosphatidylinositol 4-kinase beta, wortmannin-sensitive | |
The immunogen is a synthetic peptide directed towards the middle region of human PI4KB/PI4KIII beta (NP_002642). Peptide sequence HMDKVVQIVEIMQQGSQLPCFHGSSTIRNLKERFHMSMTEEQLQLLVEQM | |
Affinity purified |
Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin | |
Polyclonal | |
Purified | |
RUO | |
PBS buffer, 2% sucrose | |
5298 | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title