Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PIGO Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | PIGO |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP162446
|
Novus Biologicals
NBP162446 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
PIGO Polyclonal specifically detects PIGO in Human samples. It is validated for Western Blot.Specifications
| PIGO | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| class O, DKFZp434M222, EC 2.-, FLJ00135, GPI ethanolamine phosphate transferase 3, MGC20536, MGC3079, phosphatidylinositol glycan anchor biosynthesis, class O, Phosphatidylinositol-glycan biosynthesis class O protein, PIG-O, RP11-182N22.4 | |
| PIGO | |
| IgG | |
| Affinity Purified | |
| 74 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| B1AML3 | |
| 84720 | |
| Synthetic peptides corresponding to PIGO(phosphatidylinositol glycan anchor biosynthesis, class O) The peptide sequence was selected from the N terminal of PIGO. Peptide sequence LIDALRFDFAQPQHSHVPREPPVSLPFLGKLSSLQRILEIQPHHARLYRS. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title