Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PIGS Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | PIGS |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP174155
|
Novus Biologicals
NBP174155 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
PIGS Polyclonal specifically detects PIGS in Mouse samples. It is validated for Western Blot.Specifications
| PIGS | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| DKFZp686K20216, FLJ45226, GPI transamidase component PIG-S, GPI transamidase subunit, phosphatidylinositol glycan anchor biosynthesis, class S, phosphatidylinositol glycan, class S, Phosphatidylinositol-glycan biosynthesis class S protein | |
| PIGS | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q6PD26 | |
| 94005 | |
| Synthetic peptides corresponding to thesis class S Antibody against the C terminal of Pigs. Immunizing peptide sequence AVAAVQKAAKALALGHLSSAFAASQEAVTSSERAFFDPSLLHLLYFPDDQ. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title