Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PIGV Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$149.00 - $299.00
Specifications
| Antigen | PIGV |
|---|---|
| Immunogen | Synthetic peptides corresponding to PIGV(phosphatidylinositol glycan anchor biosynthesis, class V) The peptide sequence was selected from the N terminal of PIGV. Peptide sequence FVDQLVEGLLGGLSHWDAEHFLFIAEHGYLYEHNFAFFPGFPLALLVGTE. |
| Host Species | Rabbit |
| Primary or Secondary | Primary |
| Monoclonal or Polyclonal | Polyclonal |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
| NBP16244920 |
Novus Biologicals
NBP16244920UL |
20ul |
Each for $149.00
|
|
NBP162449 |
Novus Biologicals
NBP162449 |
100ul |
Each for $299.00
|
|
Description
PIGV Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blotting.Specifications
| PIGV | |
| Rabbit | |
| Polyclonal | |
| Unconjugated | |
| 55650 | |
| Purified | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| RUO |
| Synthetic peptides corresponding to PIGV(phosphatidylinositol glycan anchor biosynthesis, class V) The peptide sequence was selected from the N terminal of PIGV. Peptide sequence FVDQLVEGLLGGLSHWDAEHFLFIAEHGYLYEHNFAFFPGFPLALLVGTE. | |
| Primary | |
| IgG | |
| EC 2.4.1.-, FLJ20477, GPI mannosyltransferase 2, GPI mannosyltransferase II, GPI-MT-II, phosphatidylinositol glycan anchor biosynthesis, class V, phosphatidylinositol glycan, class V, Phosphatidylinositol-glycan biosynthesis class V protein, PIG-V, Ybr004c homolog | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| Protein A purified | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title