Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PIGV Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen PIGV
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Form Purified
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP162449
View Documents
Novus Biologicals
NBP162449
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

PIGV Polyclonal specifically detects PIGV in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications

Specifications

PIGV
Polyclonal
Purified
RUO
Q9NUD9
55650
Synthetic peptides corresponding to PIGV(phosphatidylinositol glycan anchor biosynthesis, class V) The peptide sequence was selected from the N terminal of PIGV. Peptide sequence FVDQLVEGLLGGLSHWDAEHFLFIAEHGYLYEHNFAFFPGFPLALLVGTE.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Unconjugated
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
EC 2.4.1.-, FLJ20477, GPI mannosyltransferase 2, GPI mannosyltransferase II, GPI-MT-II, phosphatidylinositol glycan anchor biosynthesis, class V, phosphatidylinositol glycan, class V, Phosphatidylinositol-glycan biosynthesis class V protein, PIG-V, Ybr004c homolog
PIGV
IgG
Protein A purified
56 kDa
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit