Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PIGV Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | PIGV |
---|---|
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Form | Purified |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP162449
|
Novus Biologicals
NBP162449 |
100 μL |
Each of 1 for $436.00
|
|
Description
PIGV Polyclonal specifically detects PIGV in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
PIGV | |
Polyclonal | |
Purified | |
RUO | |
Q9NUD9 | |
55650 | |
Synthetic peptides corresponding to PIGV(phosphatidylinositol glycan anchor biosynthesis, class V) The peptide sequence was selected from the N terminal of PIGV. Peptide sequence FVDQLVEGLLGGLSHWDAEHFLFIAEHGYLYEHNFAFFPGFPLALLVGTE. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
EC 2.4.1.-, FLJ20477, GPI mannosyltransferase 2, GPI mannosyltransferase II, GPI-MT-II, phosphatidylinositol glycan anchor biosynthesis, class V, phosphatidylinositol glycan, class V, Phosphatidylinositol-glycan biosynthesis class V protein, PIG-V, Ybr004c homolog | |
PIGV | |
IgG | |
Protein A purified | |
56 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title