Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PIGV Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$149.00 - $299.00

Specifications

Antigen PIGV
Immunogen Synthetic peptides corresponding to PIGV(phosphatidylinositol glycan anchor biosynthesis, class V) The peptide sequence was selected from the N terminal of PIGV. Peptide sequence FVDQLVEGLLGGLSHWDAEHFLFIAEHGYLYEHNFAFFPGFPLALLVGTE.
Host Species Rabbit
Primary or Secondary Primary
Monoclonal or Polyclonal Polyclonal
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP16244920 View Documents Novus BiologicalsSupplier Diversity Partner
NBP16244920UL
20ul Each for $149.00
Add to cart
 
NBP162449 View Documents Novus BiologicalsSupplier Diversity Partner
NBP162449
100ul Each for $299.00
Add to cart
 
Description

Description

PIGV Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blotting.
Specifications

Specifications

PIGV
Rabbit
Polyclonal
Unconjugated
55650
Purified
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
RUO
Synthetic peptides corresponding to PIGV(phosphatidylinositol glycan anchor biosynthesis, class V) The peptide sequence was selected from the N terminal of PIGV. Peptide sequence FVDQLVEGLLGGLSHWDAEHFLFIAEHGYLYEHNFAFFPGFPLALLVGTE.
Primary
IgG
EC 2.4.1.-, FLJ20477, GPI mannosyltransferase 2, GPI mannosyltransferase II, GPI-MT-II, phosphatidylinositol glycan anchor biosynthesis, class V, phosphatidylinositol glycan, class V, Phosphatidylinositol-glycan biosynthesis class V protein, PIG-V, Ybr004c homolog
PBS and 2% Sucrose with 0.09% Sodium Azide
Protein A purified
Store at -20C. Avoid freeze-thaw cycles.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit