PIK3R3 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP257974

Catalog No. NBP257974

Description

PI 3-Kinase p55 gamma Polyclonal specifically detects PI 3-Kinase p55 gamma in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: PIK3R3
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: 100% homology to SWISS-PROT Q92569, DKFZp686P05226, FLJ41892, p55, Phosphatidylinositol 3-kinase 55 kDa regulatory subunit gamma, phosphoinositide-3-kinase, regulatory subunit 3 (gamma), phosphoinositide-3-kinase, regulatory subunit 3 (p55, gamma), phosphoinositide-3-kinase, regulatory subunit, polypeptide 3 (p55, gamma), PI3K regulatory subunit gamma, PI3-kinase subunit p55-gamma, regulatory subunit, polypeptide 3 (p55, gamma)
• Host Species: Rabbit
• Molecular Weight of Antigen: 54 kDa
• Quantity: 100 μL
• Research Discipline: Cancer, Diabetes Research, mTOR Pathway, Neuroscience, Signal Transduction
• Gene ID (Entrez): 8503
• Target Species: Human
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: PIK3R3
• Immunogen: PI 3-Kinase p55 gamma Antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MYNTVWSMDRDDADWREVMMPYSTELIFYIEMD
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only