Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PIN/DLC8 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP154949

 View more versions of this product

Catalog No. NBP154949

Add to cart



PIN/DLC8 Polyclonal antibody specifically detects PIN/DLC8 in Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish samples. It is validated for Western Blot.


PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
Synthetic peptides corresponding to DYNLL1(dynein, light chain, LC8-type 1) The peptide sequence was selected from the N terminal of DYNLL1. Peptide sequence MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKY.
10 kDa
100 ul
p53 Pathway
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Western Blot
Western Blot 1:100-1:2000
cytoplasmic dynein light polypeptide, DLC1DNCLC1, DLC8MGC126137, DNCL1MGC126138, dynein light chain 1, cytoplasmic, Dynein light chain LC8-type 1, dynein, cytoplasmic, light polypeptide 1, dynein, light chain, LC8-type 1,8 kDa dynein light chain, hdlc1, LC8, PINLC8a, Protein inhibitor of neuronal nitric oxide synthase
Immunogen affinity purified
Store at -20C. Avoid freeze-thaw cycles.
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit