Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Pipecolic acid oxidase Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | Pipecolic acid oxidase |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP160060
|
Novus Biologicals
NBP160060 |
100 μL |
Each of 1 for $436.00
|
|
Description
Pipecolic acid oxidase Polyclonal specifically detects Pipecolic acid oxidase in Human samples. It is validated for Western Blot.Specifications
Pipecolic acid oxidase | |
Polyclonal | |
Rabbit | |
Amino Acids Drugs and other small molecules, Cell Biology, Core ESC Like Genes, Lipid and Metabolism, Stem Cell Markers | |
EC 1.5.3.1, EC 1.5.3.7, L-pipecolate oxidase, L-pipecolic acid oxidase, LPIPOXperoxisomal sarcosine oxidase, pipecolic acid oxidase, PSO | |
PIPOX | |
IgG | |
Affinity Purified |
Western Blot | |
Unconjugated | |
RUO | |
Q9P0Z9 | |
51268 | |
Synthetic peptides corresponding to PIPOX(pipecolic acid oxidase) The peptide sequence was selected from the C terminal of PIPOX. Peptide sequence FVRDHLPDLKPEPAVIESCMYTNTPDEQFILDRHPKYDNIVIGAGFSGHG. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title