Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Pipecolic acid oxidase Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen Pipecolic acid oxidase
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP160060
View Documents
Novus Biologicals
NBP160060
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

Pipecolic acid oxidase Polyclonal specifically detects Pipecolic acid oxidase in Human samples. It is validated for Western Blot.
Specifications

Specifications

Pipecolic acid oxidase
Polyclonal
Rabbit
Amino Acids Drugs and other small molecules, Cell Biology, Core ESC Like Genes, Lipid and Metabolism, Stem Cell Markers
EC 1.5.3.1, EC 1.5.3.7, L-pipecolate oxidase, L-pipecolic acid oxidase, LPIPOXperoxisomal sarcosine oxidase, pipecolic acid oxidase, PSO
PIPOX
IgG
Affinity Purified
Western Blot
Unconjugated
RUO
Q9P0Z9
51268
Synthetic peptides corresponding to PIPOX(pipecolic acid oxidase) The peptide sequence was selected from the C terminal of PIPOX. Peptide sequence FVRDHLPDLKPEPAVIESCMYTNTPDEQFILDRHPKYDNIVIGAGFSGHG.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit