PIST Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP155206

Catalog No. NBP155206

Description

PIST Polyclonal specifically detects PIST in Human samples. It is validated for Western Blot.

Specifications

• Antigen: PIST
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: CALPDZ protein interacting specifically with TC10, CFTR-associated ligand, dJ94G16.2, FIGdJ94G16.2 PIST, Fused in glioblastoma, golgi-associated PDZ and coiled-coil motif containing, Golgi-associated PDZ and coiled-coil motif-containing protein, GOPC1, PDZ/coiled-coil domain binding partner for the rho-family GTPase TC10, PISTGolgi associated PDZ and coiled-coil motif containing protein
• Host Species: Rabbit
• Molecular Weight of Antigen: 50 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: GOPC
• Immunogen: Synthetic peptides corresponding to GOPC(golgi associated PDZ and coiled-coil motif containing) The peptide sequence was selected from the N terminal of GOPC. Peptide sequence EVLEKEFDKAFVDVDLLLGEIDPDQADITYEGRQKMTSLSSCFAQLCHKA.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 57120
• Target Species: Human, Mouse, Rat, Bovine, Canine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG