Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PIST Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15520620UL
Description
PIST Polyclonal specifically detects PIST in Human samples. It is validated for Western Blot.Specifications
| PIST | |
| Polyclonal | |
| Western Blot 1:100-1:2000 | |
| CALPDZ protein interacting specifically with TC10, CFTR-associated ligand, dJ94G16.2, FIGdJ94G16.2 PIST, Fused in glioblastoma, golgi-associated PDZ and coiled-coil motif containing, Golgi-associated PDZ and coiled-coil motif-containing protein, GOPC1, PDZ/coiled-coil domain binding partner for the rho-family GTPase TC10, PISTGolgi associated PDZ and coiled-coil motif containing protein | |
| Rabbit | |
| 50 kDa | |
| 20 μL | |
| Primary | |
| Human | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| GOPC | |
| Synthetic peptides corresponding to GOPC(golgi associated PDZ and coiled-coil motif containing) The peptide sequence was selected from the N terminal of GOPC. Peptide sequence EVLEKEFDKAFVDVDLLLGEIDPDQADITYEGRQKMTSLSSCFAQLCHKA. | |
| Affinity Purified | |
| RUO | |
| 57120 | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title