Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PIST Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen PIST
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15520620
View Documents
Novus Biologicals
NBP15520620UL
20 μL
Each for $152.22
Add to cart
 
NBP155206
View Documents
Novus Biologicals
NBP155206
100 μL
Each for $436.00
Add to cart
 
Description

Description

PIST Polyclonal specifically detects PIST in Human samples. It is validated for Western Blot.
Specifications

Specifications

PIST
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
57120
Synthetic peptides corresponding to GOPC(golgi associated PDZ and coiled-coil motif containing) The peptide sequence was selected from the N terminal of GOPC. Peptide sequence EVLEKEFDKAFVDVDLLLGEIDPDQADITYEGRQKMTSLSSCFAQLCHKA.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
CALPDZ protein interacting specifically with TC10, CFTR-associated ligand, dJ94G16.2, FIGdJ94G16.2 PIST, Fused in glioblastoma, golgi-associated PDZ and coiled-coil motif containing, Golgi-associated PDZ and coiled-coil motif-containing protein, GOPC1, PDZ/coiled-coil domain binding partner for the rho-family GTPase TC10, PISTGolgi associated PDZ and coiled-coil motif containing protein
GOPC
IgG
Affinity Purified
50 kDa
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit