Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PIWIL4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP154343
Description
PIWIL4 Polyclonal specifically detects PIWIL4 in Human samples. It is validated for Western Blot.Specifications
| PIWIL4 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| DKFZp686P01248, FLJ36156, HIWI2MIWI2, Miwi2, PIWI, piwi-like 4 (Drosophila), piwi-like protein 4 | |
| Rabbit | |
| 96 kDa | |
| 100 μL | |
| Primary | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| Q7Z3Z4 | |
| PIWIL4 | |
| Synthetic peptide directed towards the N terminal of human PIWIL4 (NP_689644). Peptide sequence SGRARVKARGIARSPSATEVGRIQASPLPRSVDLSNNEASSSNGFLGTSR. | |
| Affinity purified | |
| RUO | |
| 143689 | |
| Human | |
| IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction