Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PKC beta Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $352.89

Specifications

Antigen PKC beta
Dilution Western Blot 1.0 ug/ml
Applications Western Blot
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB125472
View Documents
Novus Biologicals
NBP31028525UL
25 μg
Each for $106.19
Add to cart
 
NB125471
View Documents
Novus Biologicals
NBP310285100UL
100 μg
Each for $352.89
Add to cart
 
Description

Description

PKC beta Polyclonal antibody specifically detects PKC beta in Human samples. It is validated for Western Blot
Specifications

Specifications

PKC beta
Western Blot
Purified
RUO
Human
EC 2.7.11, EC 2.7.11.13, MGC41878, PKC-B, PKC-beta, PKCBPRKCB2, PRKCB1protein kinase C beta 1, protein kinase C beta type, protein kinase C, beta, protein kinase C, beta 1, protein kinase C, beta 1 polypeptide
The immunogen is a synthetic peptide directed towards the C terminal region of human PKC beta1 (NP_002729.2). Peptide sequence KPKARDKRDTSNFDKEFTRQPVELTPTDKLFIMNLDQNEFAGFSYTNPEF
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot 1.0 ug/ml
Unconjugated
Rabbit
Cancer, mTOR Pathway, Phospho Specific, Protein Kinase, Signal Transduction, Wnt Signaling Pathway
PBS buffer, 2% sucrose
5579
Polyclonal
Affinity purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit