Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PLA2G4B Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP180305

 View more versions of this product

Catalog No. NBP180305


Add to cart

Description

Description

PLA2G4B Polyclonal antibody specifically detects PLA2G4B in Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit samples. It is validated for Western Blot.
Specifications

Specifications

PLA2G4B
Unconjugated
PBS & 2% Sucrose. with 0.09% Sodium Azide
Affinity Purified
JMJD7-PLA2G4B
Synthetic peptide directed towards the N terminal of human PLA2G4B. Peptide sequence: AEAALEAVRSELREFPAAARELCVPLAVPYLDKPPTPLHFYRDWVCPNRP
Immunogen affinity purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Expected identity based on immunogen sequence: Canine: 92%; Equine: 92%; Guinea pig: 85%; Mouse: 78%; Rat: 78%.
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat
Western Blot
Western Blot 1:1000
NP_005081
FLJ20543, FLJ20656, FLJ20807, FLJ77014, FLJ78330, jmjC domain-containing protein 7, jumonji domain containing 7, Jumonji domain-containing protein 7
Rabbit
IgG
100 ul
Signal Transduction
Primary
8681
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit