Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PLS1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
$152.22 - $436.00
Specifications
Antigen | PLS1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP15655520
|
Novus Biologicals
NBP15655520UL |
20 μL |
Each for $152.22
|
|
NBP156555
|
Novus Biologicals
NBP156555 |
100 μL |
Each for $436.00
|
|
Description
PLS1 Polyclonal specifically detects PLS1 in Human, Mouse samples. It is validated for Western Blot.Specifications
PLS1 | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
fimbrin, I plastin, intestine specific plastin, Intestine-specific plastin, I-plastin, plastin 1, plastin 1 (I isoform), Plastin-1 | |
PLS1 | |
IgG | |
Affinity Purified |
Western Blot | |
Unconjugated | |
RUO | |
Q14651 | |
5357 | |
Synthetic peptides corresponding to PLS1(plastin 1 (I isoform)) The peptide sequence was selected from the N terminal of PLS1. Peptide sequence ISFEEFVSLMQELKSKDISKTFRKIINKREGITAIGGTSTISSEGTQHSY. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title