PLSCR3 Rabbit anti-Human, Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP152866

Catalog No. NBP152866

Description

PLSCR3 Polyclonal specifically detects PLSCR3 in Human, Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: PLSCR3
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9NRY6
• Gene Symbols: PLSCR3
• Immunogen: Synthetic peptides corresponding to PLSCR3(phospholipid scramblase 3) The peptide sequence was selected from the middle region of PLSCR3. Peptide sequence GCGTDTNFEVKTRDESRSVGRISKQWGGLVREALTDADDFGLQFPLDLDV.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Zebrafish: 85%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Ca(2+)-dependent phospholipid scramblase 3, phospholipid scramblase 3, PL scramblase 3
• Host Species: Rabbit
• Molecular Weight of Antigen: 32 kDa
• Quantity: 100 μL
• Research Discipline: metabolism
• Gene ID (Entrez): 57048
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.