Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PLSCR3 Rabbit anti-Human, Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | PLSCR3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP152866
|
Novus Biologicals
NBP152866 |
100 μL |
Each for $436.00
|
|
NBP15286620
|
Novus Biologicals
NBP15286620UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
PLSCR3 Polyclonal specifically detects PLSCR3 in Human, Mouse samples. It is validated for Western Blot.Specifications
| PLSCR3 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| Ca(2+)-dependent phospholipid scramblase 3, phospholipid scramblase 3, PL scramblase 3 | |
| PLSCR3 | |
| IgG | |
| Affinity Purified | |
| 32 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q9NRY6 | |
| 57048 | |
| Synthetic peptides corresponding to PLSCR3(phospholipid scramblase 3) The peptide sequence was selected from the middle region of PLSCR3. Peptide sequence GCGTDTNFEVKTRDESRSVGRISKQWGGLVREALTDADDFGLQFPLDLDV. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title