Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PM20D1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $320.71

Specifications

Antigen PM20D1
Dilution Western Blot 1.0 ug/ml
Applications Western Blot
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB124654
View Documents
Novus Biologicals
NBP30987625UL
25 μg
Each for $106.19
Add to cart
 
NB124653
View Documents
Novus Biologicals
NBP309876100UL
100 μg
Each for $320.71
Add to cart
 
Description

Description

PM20D1 Polyclonal antibody specifically detects PM20D1 in Human samples. It is validated for Western Blot
Specifications

Specifications

PM20D1
Western Blot
Purified
RUO
PBS buffer, 2% sucrose
148811
Polyclonal
Affinity purified
Western Blot 1.0 ug/ml
Unconjugated
Rabbit
Human
Cps1, EC 3.4.17.-, FLJ32569, peptidase M20 domain containing 1, Peptidase M20 domain-containing protein 1, probable carboxypeptidase PM20D1
The immunogen is a synthetic peptide directed towards the N-terminal region of Human PM20D1 (NP_689704). Peptide sequence SMGPRSGEHQRASRIPSQFSKEERVAMKEALKGAIQIPTVTFSSEKSNTT
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit