Invitrogen™ PML Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA579835

Catalog No. PIPA579835

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human Hela whole cell, human HEK293 whole cell, human U87 whole cell, human A431 whole cell, human K562 whole cell. IHC: human intestinal cancer tissue, human mammary cancer tissue. Flow: A431 cell.

The protein encoded by this gene is one of two human homologs of Saccharomyces cerevisiae Rad23, a protein involved in nucleotide excision repair (NER). This protein was shown to interact with, and elevate the nucleotide excision activity of 3-methyladenine-DNA glycosylase (MPG), which suggested a role in DNA damage recognition in base excision repair. This protein contains an N-terminal ubiquitin-like domain, which was reported to interact with 26S proteasome, as well as with ubiquitin protein ligase E6AP, and thus suggests that this protein may be involved in the ubiquitin mediated proteolytic pathway in cells.

Specifications

• Antigen: PML
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: PML
• Gene Alias: 1200009E24Rik; AI661194; MYL; Pml; PML/RARA fusion; pml1; PP8675; probable transcription factor PML; promyelocytic leukemia; promyelocytic leukemia protein; promyelocytic leukemia, inducer of; protein PML; RGD1562602; RING finger protein 71; RNF71; TRIM19; tripartite motif protein TRIM19; tripartite motif-containing protein 19
• Host Species: Rabbit
• Purification Method: Antigen Affinity Chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 5371
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
• Concentration: 500 μg/mL
• Formulation: PBS with 5mg BSA and 0.05mg sodium azide
• Gene Accession No.: P29590
• Gene Symbols: PML
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human PML Protein (141-179aa FECEQLLCAKCFEAHQWFLKHEARPLAELRNQSVREFLD).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG