Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PNMA1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | PNMA1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP152936
|
Novus Biologicals
NBP152936 |
100 μL |
Each of 1 for $436.00
|
|
Description
PNMA1 Polyclonal specifically detects PNMA1 in Human samples. It is validated for Western Blot.Specifications
PNMA1 | |
Polyclonal | |
Rabbit | |
Q8ND90 | |
9240 | |
Synthetic peptides corresponding to PNMA1(paraneoplastic antigen MA1) The peptide sequence was selected from the middle region of PNMA1. Peptide sequence LNTYQNPGEKLSAYVIRLEPLLQKVVEKGAIDKDNVNQARLEQVIAGANH. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
RUO | |
MA1Neuron- and testis-specific protein 1,37 kDa neuronal protein, paraneoplastic antigen MA1, paraneoplastic neuronal antigen MA1 | |
PNMA1 | |
IgG | |
Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title