Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PNMA1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen PNMA1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP152935
View Documents
Novus Biologicals
NBP152935
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

PNMA1 Polyclonal specifically detects PNMA1 in Human samples. It is validated for Western Blot.
Specifications

Specifications

PNMA1
Polyclonal
Rabbit
Q8ND90
9240
Synthetic peptides corresponding to PNMA1(paraneoplastic antigen MA1) The peptide sequence was selected from the middle region of PNMA1. Peptide sequence KSNNPAITTAECLKALEQVFGSVESSRDAQIKFLNTYQNPGEKLSAYVIR.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
MA1Neuron- and testis-specific protein 1,37 kDa neuronal protein, paraneoplastic antigen MA1, paraneoplastic neuronal antigen MA1
PNMA1
IgG
Affinity Purified
40 kDa
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit