Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PNMA3 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $352.89

Specifications

Antigen PNMA3
Dilution Western Blot 1.0 ug/ml
Applications Western Blot
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB123562
View Documents
Novus Biologicals
NBP30933025UL
25 μg
Each for $106.19
Add to cart
 
NB123561
View Documents
Novus Biologicals
NBP309330100UL
100 μg
Each for $352.89
Add to cart
 
Description

Description

PNMA3 Polyclonal antibody specifically detects PNMA3 in Human samples. It is validated for Western Blot
Specifications

Specifications

PNMA3
Western Blot
Purified
RUO
PBS buffer, 2% sucrose
29944
Polyclonal
Affinity purified
Western Blot 1.0 ug/ml
Unconjugated
Rabbit
Human
MA3MA5, MGC132756, MGC132758, paraneoplastic antigen MA3, paraneoplastic cancer-testis-brain antigen
The immunogen is a synthetic peptide directed towards the middle region of human PNMA3 (NP_037496). Peptide sequence RITGVGAVPLPASGNSFDVRPSQGYRRRRGRGQHRRGGVARAGSRGSRKR
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit