Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
POFUT2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | POFUT2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP158054
|
Novus Biologicals
NBP158054 |
100 μL |
Each for $436.00
|
|
NBP15805420
|
Novus Biologicals
NBP15805420UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
POFUT2 Polyclonal specifically detects POFUT2 in Human samples. It is validated for Western Blot.Specifications
| POFUT2 | |
| Polyclonal | |
| Rabbit | |
| Lipid and Metabolism | |
| Q9Y2G5 | |
| 23275 | |
| Synthetic peptides corresponding to POFUT2(protein O-fucosyltransferase 2) The peptide sequence was selected from the N terminal of POFUT2. Peptide sequence GAASRRRYLLYDVNPPEGFNLRRDVYIRIASLLKTLLKTEEWVLVLPPWG. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| C21orf80, chromosome 21 open reading frame 80, FUT13EC 2.4.1.221, GDP-fucose protein O-fucosyltransferase 2, KIAA0958, O-FucT-2, Peptide-O-fucosyltransferase 2, protein O-fucosyltransferase 2 | |
| POFUT2 | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title