Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
POLR1D Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP152917
Description
POLR1D Polyclonal specifically detects POLR1D in Human samples. It is validated for Western Blot.Specifications
POLR1D | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
AC19, DNA-directed RNA polymerase I subunit D, DNA-directed RNA polymerases I and III subunit RPAC2, FLJ20616, hRPA19, MGC9850, POLR1C, polymerase (RNA) I polypeptide D, 16kDa, RPA16RNA polymerase I 16 kDa subunit, RPA9, RPAC2RNA polymerases I and III subunit AC2, RPC16, RPO1-3, TCS2 | |
Rabbit | |
Affinity purified | |
RUO | |
51082 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
Q9Y2S0 | |
POLR1D | |
Synthetic peptides corresponding to POLR1D(polymerase (RNA) I polypeptide D, 16kDa) The peptide sequence was selected from the middle region of POLR1D. Peptide sequence TRGTLPAVEPFQRGLNELMNVCQHVLDKFEASIKDYKDQKASRNESTF. | |
100 μL | |
Primary | |
This product is specific to Subunit or Isoform: RPAC2. | |
Human, Bovine, Canine, Rabbit | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction