Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

POLR1D Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP152917

 View more versions of this product

Catalog No. NBP152917


Add to cart

Description

Description

POLR1D Polyclonal antibody specifically detects POLR1D in Human, Bovine, Canine, Rabbit samples. It is validated for Western Blot.
Specifications

Specifications

POLR1D
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
POLR1D
Synthetic peptides corresponding to POLR1D(polymerase (RNA) I polypeptide D, 16kDa) The peptide sequence was selected from the middle region of POLR1D. Peptide sequence TRGTLPAVEPFQRGLNELMNVCQHVLDKFEASIKDYKDQKASRNESTF.
Immunogen affinity purified
RUO
Primary
51082
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Western Blot
Western Blot 1:100-1:2000
Q9Y2S0
AC19, DNA-directed RNA polymerase I subunit D, DNA-directed RNA polymerases I and III subunit RPAC2, FLJ20616, hRPA19, MGC9850, POLR1C, polymerase (RNA) I polypeptide D, 16kDa, RPA16RNA polymerase I 16 kDa subunit, RPA9, RPAC2RNA polymerases I and III subunit AC2, RPC16, RPO1-3, TCS2
Rabbit
IgG
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
This product is specific to Subunit or Isoform: RPAC2.
Bovine, Canine, Human, Rabbit
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit