Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

POLR2J3 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $352.89

Specifications

Antigen POLR2J3
Dilution Western Blot 1.0 ug/ml
Applications Western Blot
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB124273
View Documents
Novus Biologicals
NBP309686100UL
100 μg
Each for $352.89
Add to cart
 
NB124274
View Documents
Novus Biologicals
NBP30968625UL
25 μg
Each for $106.19
Add to cart
 
Description

Description

POLR2J3 Polyclonal antibody specifically detects POLR2J3 in Human samples. It is validated for Western Blot
Specifications

Specifications

POLR2J3
Western Blot
Purified
RUO
PBS buffer, 2% sucrose
548644
Polyclonal
Affinity purified
Western Blot 1.0 ug/ml
Unconjugated
Rabbit
Human
DNA-Directed RNA Polymerase II Subunit 11, DNA-Directed RNA Polymerase II Subunit J3, DNA-Directed RNA Polymerase II Subunit RPB11-B2, Polymerase (RNA) II (DNA Directed) Polypeptide J3, Polymerase (RNA) II Subunit J3, RNA Polymerase II Subunit B11-B2, RNA Polymerase II Subunit J3, RPB11b1, RPB11b2
The immunogen is a synthetic peptide directed towards the N-terminal region of Human POLR2J2 (NP_001091084). Peptide sequence APPAFESFLLFEGEKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKD
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit