Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

POLR3A Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP153051

 View more versions of this product

Catalog No. NBP153051


Add to cart

Description

Description

POLR3A Polyclonal antibody specifically detects POLR3A in Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Yeast samples. It is validated for Western Blot.
Specifications

Specifications

POLR3A
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
POLR3A
Synthetic peptides corresponding to POLR3A(polymerase (RNA) III (DNA directed) polypeptide A, 155kDa) The peptide sequence was selected from the middle region of POLR3A (NP_008986). Peptide sequence AYFGQKDSVCGVSECIIMGIPMNIGTGLFKLLHKADRDPNPPKRPLIFDT.
156 kDa
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
This product is specific to Subunit or Isoform: RPC1.
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Yeast
Western Blot
Western Blot 0.2-1 ug/ml
O14802
DNA-directed RNA polymerase III largest subunit, DNA-directed RNA polymerase III subunit A, DNA-directed RNA polymerase III subunit RPC1, EC 2.7.7.6, hRPC155, POL3A, polymerase (RNA) III (DNA directed) polypeptide A, 155kDa, RNA polymerase III 155 kDa subunit, RNA polymerase III subunit C160, RNA polymerase III subunit RPC155-D, RPC1, RPC155RNA polymerase III subunit C1
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
11128
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit