Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

POLR3B Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP154363

 View more versions of this product

Catalog No. NBP154363


Add to cart

Description

Description

POLR3B Polyclonal antibody specifically detects POLR3B in Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit, Yeast, Zebrafish samples. It is validated for Western Blot.
Specifications

Specifications

POLR3B
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
POLR3B
Synthetic peptides corresponding to POLR3B(polymerase (RNA) III (DNA directed) polypeptide B) The peptide sequence was selected from the C terminal of POLR3B. Peptide sequence IEKVMISSNAEDAFLIKMLLRQTRRPEIGDKFSSRHGQKGVCGLIVPQED.
128 kDa
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
This product is specific to Subunit or Isoform: RPC2.
Bovine, Canine, Equine, Goat, Guinea Pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Western Blot
Western Blot 1:100-1:2000
Q9NW08
C128, DKFZp686B10117, DNA-directed RNA polymerase III 127.6 kDa polypeptide, DNA-directed RNA polymerase III subunit B, DNA-directed RNA polymerase III subunit RPC2, EC 2.7.7.6, FLJ10388, polymerase (RNA) III (DNA directed) polypeptide B, RNA polymerase III subunit C2, RPC2
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
55703
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit